PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005617P3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 146aa    MW: 17185.9 Da    PI: 9.6696
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005617P3genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.2e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+s+
  MELO3C005617P3  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSN 59
                    79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.286161IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33382IPR002100Transcription factor, MADS-box
CDDcd002655.09E-44378No hitNo description
PfamPF003192.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSNC  60
SMNKTIDRYQ NRTKDLMSSN STATEDVQLE KEYDSFSMTK KLEHLEVCKR FEIILMNTHT  120
KEKVYFLNFC YILRAWFELQ NHFLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A2e-18369268Myocyte-specific enhancer factor 2A
3kov_B2e-18369268Myocyte-specific enhancer factor 2A
3kov_I2e-18369268Myocyte-specific enhancer factor 2A
3kov_J2e-18369268Myocyte-specific enhancer factor 2A
3mu6_A1e-18369268Myocyte-specific enhancer factor 2A
3mu6_B1e-18369268Myocyte-specific enhancer factor 2A
3mu6_C1e-18369268Myocyte-specific enhancer factor 2A
3mu6_D1e-18369268Myocyte-specific enhancer factor 2A
3p57_A2e-18369268Myocyte-specific enhancer factor 2A
3p57_B2e-18369268Myocyte-specific enhancer factor 2A
3p57_C2e-18369268Myocyte-specific enhancer factor 2A
3p57_D2e-18369268Myocyte-specific enhancer factor 2A
3p57_I2e-18369268Myocyte-specific enhancer factor 2A
3p57_J2e-18369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818951e-96LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132631e-96LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437190.11e-75PREDICTED: agamous-like MADS-box protein AGL19
RefseqXP_008437191.11e-75PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO646456e-48SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A067K1644e-52A0A067K164_JATCU; Uncharacterized protein
STRINGVIT_02s0025g04650.t017e-46(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-49AGAMOUS-like 20